Cusabio Rattus norvegicus Recombinants
Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial | CSB-EP644804RA
- SKU:
- CSB-EP644804RA
- Availability:
- 13 - 23 Working Days
Description
Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial | CSB-EP644804RA | Cusabio
Alternative Name(s): Solute carrier family 39 member 13Zrt- and Irt-like protein 13 ;ZIP-13
Gene Names: Slc39a13
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA
Source: E.coli
Tag Info: N-terminal 6xHis-GST-tagged
Expression Region: 130-233aa
Sequence Info: Partial
MW: 41.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Acts as a zinc-influx transporter.
Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Acts as a zinc-influx transporter.
Involvement in disease:
Subcellular Location: Golgi apparatus membrane, Multi-pass membrane protein
Protein Families: ZIP transporter (TC 2.A.5) family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q2M1K6
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A