Recombinant Rat Vesicle-associated membrane protein 2 (Vamp2), partial | CSB-EP025781RA1

Recombinant Rat Vesicle-associated membrane protein 2 (Vamp2), partial | CSB-EP025781RA1 | Cusabio

Alternative Name(s): Vamp2; Syb2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2

Gene Names: Vamp2

Research Areas: Cancer

Organism: Rattus norvegicus (Rat)

AA Sequence: SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-94aa

Sequence Info: Partial

MW: 14.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1

Reference: "Two vesicle-associated membrane protein genes are differentially expressed in the rat central nervous system." Elferink L.A., Trimble W.S., Scheller R.H. J. Biol. Chem. 264:11061-11064(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the targeting and/or fusion of transport vesicles to their target membrane (By similarity). Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1

Involvement in disease:

Subcellular Location: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, Cell membrane

Protein Families: Synaptobrevin family

Tissue Specificity: Nervous system specific. A higher level expression is seen in the brain as compared to the spinal cord.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P63045

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A