Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial | CSB-RP156244r

Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial | CSB-RP156244r | Cusabio

Alternative Name(s): AVPR V1aAntidiuretic hormone receptor 1aVascular/hepatic-type arginine vasopressin receptor

Gene Names: Avpr1a

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 7-52aa

Sequence Info: Partial

MW: 31.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. Involved in social mory formation.

Reference: Immunocytochemical localization of vasopressin v1a receptors in the rat pituitary gonadotropes.Orcel H., Tobin V.A., Alonso G., Rabie A.Endocrinology 143:4385-4388(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily

Tissue Specificity: Localized within gonadotropes of the anterior pituitary of the brain. Broadly distributed throughout the cerebral cortex.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P30560

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A