Cusabio Rattus norvegicus Recombinants
Recombinant Rat Urokinase plasminogen activator surface receptor (Plaur) | CSB-YP018122RA
- SKU:
- CSB-YP018122RA
- Availability:
- 25 - 35 Working Days
Description
Recombinant Rat Urokinase plasminogen activator surface receptor (Plaur) | CSB-YP018122RA | Cusabio
Alternative Name(s): PlaurUrokinase plasminogen activator surface receptor; U-PAR; uPAR; CD antigen CD87
Gene Names: Plaur
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 25-299aa
Sequence Info: Full Length of Mature Protein
MW: 32.1kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Reference: Transcriptional and posttranscriptional activation of urokinase plasminogen activator gene expression in metastatic tumor cells.Henderson B.R., Tansey W.P., Phillips S.M., Ramshaw I.A., Kefford R.F.Cancer Res. 52:2489-2496(1992)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
Involvement in disease:
Subcellular Location: Isoform 1: Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P49616
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A