Cusabio Rattus norvegicus Recombinants
Recombinant Rat Trypsin-4 (Try4) | CSB-YP319450RA
- SKU:
- CSB-YP319450RA
- Availability:
- 3 - 7 Working Days
Description
Recombinant Rat Trypsin-4 (Try4) | CSB-YP319450RA | Cusabio
Alternative Name(s): Pretrypsinogen IV Trypsin IV
Gene Names: Try4
Research Areas: Cell Biology
Organism: Rattus norvegicus (Rat)
AA Sequence: IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 24-247aa
Sequence Info: Full Length of Mature Protein
MW: 26.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance:
Reference: "A fourth trypsinogen (P23) in the rat pancreas induced by CCK." Luetcke H.A., Rausch U., Vasiloudes P., Scheele G.A., Kern H.F. Nucleic Acids Res. 17:6736-6736(1989)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted, extracellular space
Protein Families: Peptidase S1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P12788
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A