Recombinant Rat Toll-like receptor 4 (Tlr4), partial | CSB-CF023603RA

(No reviews yet) Write a Review
SKU:
CSB-CF023603RA
Availability:
18 - 23 Working Days
  • Recombinant Rat Toll-like receptor 4 (Tlr4), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$772.80 - $1,082.40

Description

Recombinant Rat Toll-like receptor 4 (Tlr4), partial | CSB-CF023603RA | Cusabio

Alternative Name(s): CD_antigen: CD284

Gene Names: Tlr4

Research Areas: Immunology

Organism: Rattus norvegicus (Rat)

AA Sequence: NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVS

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 26-638aa

Sequence Info: Extracellular Domain

MW: 90.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate. In complex with TLR6, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. Binds electronegative LDL (LDL-) and mediates the cytokine release induced by LDL

Reference: "Toll-like receptor 4: the missing link of the cerebral innate immune response triggered by circulating gram-negative bacterial cell wall components."Laflamme N., Rivest S.FASEB J. 15:155-163(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate. In complex with TLR6, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-) (By similarity).

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein, Early endosome

Protein Families: Toll-like receptor family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9QX05

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose