Recombinant Rat Thyroglobulin (Tg), partial | CSB-EP023442RA

(No reviews yet) Write a Review
SKU:
CSB-EP023442RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Thyroglobulin (Tg), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Rat Thyroglobulin (Tg), partial | CSB-EP023442RA | Cusabio

Alternative Name(s): Tg

Gene Names: Tg

Research Areas: Signal Transduction

Organism: Rattus norvegicus (Rat)

AA Sequence: NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-300aa

Sequence Info: Partial

MW: 48 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).

Reference: "A novel missense mutation (G2320R) in thyroglobulin causes hypothyroidism in rdw rats."Hishinuma A., Furudate S., Oh-Ishi M., Nagakubo N., Namatame T., Ieiri T.Endocrinology 141:4050-4055(2000).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).

Involvement in disease: Defects in Tg are a cause of a form of hypothyroidism in rdw rat.

Subcellular Location: Secreted

Protein Families: Type-B carboxylesterase/lipase family

Tissue Specificity: Thyroid gland specific.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P06882

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose