Cusabio Rattus norvegicus Recombinants
Recombinant Rat Thyroglobulin (Tg), partial | CSB-EP023442RA
- SKU:
- CSB-EP023442RA
- Availability:
- 3 - 7 Working Days
Description
Recombinant Rat Thyroglobulin (Tg), partial | CSB-EP023442RA | Cusabio
Alternative Name(s): Tg
Gene Names: Tg
Research Areas: Signal Transduction
Organism: Rattus norvegicus (Rat)
AA Sequence: NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 21-300aa
Sequence Info: Partial
MW: 48 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).
Reference: "A novel missense mutation (G2320R) in thyroglobulin causes hypothyroidism in rdw rats."Hishinuma A., Furudate S., Oh-Ishi M., Nagakubo N., Namatame T., Ieiri T.Endocrinology 141:4050-4055(2000).
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).
Involvement in disease: Defects in Tg are a cause of a form of hypothyroidism in rdw rat.
Subcellular Location: Secreted
Protein Families: Type-B carboxylesterase/lipase family
Tissue Specificity: Thyroid gland specific.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P06882
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: N/A
STRING Database Link: STRING
OMIM Database Link: N/A