Recombinant Rat Secretogranin-3 (Scg3) | CSB-EP020809RA

(No reviews yet) Write a Review
SKU:
CSB-EP020809RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Secretogranin-3 (Scg3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Rat Secretogranin-3 (Scg3) | CSB-EP020809RA | Cusabio

Alternative Name(s): 1B1075;Secretogranin III;SgIII

Gene Names: Scg3

Research Areas: Neuroscience

Organism: Rattus norvegicus (Rat)

AA Sequence: FPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKTYPSESKPSESNFSSVDNLNLLKAITEKETVEKAKQSIRSSPFDNRLNVDDADSTKNRKLTDEYDSTKSGLDRKVQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRGVFDKIVSKLLNLGLITESQAHTLEDEVAEALQKLISKEANNYEEAPEKPTSRTENQDGKIPEKVTPVAATQDGFTNRENDDTVSNTLTLSNGLERRTNPHRDDDFEELQYFPNFYALLTSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDETIALQTKNKLEKNTTDSKSKLFPAPPEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNLGGKTDEAKGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKGILDKEEANAIKRIYSSL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 23-471aa

Sequence Info: Full Length of Mature Protein

MW: 58.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Member of the granin protein family that regulates the biogenesis of secretory granules (PubMed:12388744, PubMed:14597614). Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA (PubMed:12388744, PubMed:14597614). May also play a role in angiogenesis. Promotes endothelial proliferation, migration and tube formation through MEK/ERK signaling pathway (By similarity).

Reference: "Secretogranin III binds to cholesterol in the secretory granule membrane as an adapter for chromogranin A." Hosaka M., Suda M., Sakai Y., Izumi T., Watanabe T., Takeuchi T. J. Biol. Chem. 279:3627-3634(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P47868

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose