Recombinant Rat Sclerostin (Sost) | CSB-EP859165RA

(No reviews yet) Write a Review
SKU:
CSB-EP859165RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Sclerostin (Sost)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP859165RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sost.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP859165RA could indicate that this peptide derived from E.coli-expressed
$422.40 - $2,042.40

Description

Recombinant Rat Sclerostin (Sost) | CSB-EP859165RA | Cusabio

Alternative Name(s): Sost; Sclerostin

Gene Names: Sost

Research Areas: Stem Cells

Organism: Rattus norvegicus (Rat)

AA Sequence: FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 29-213aa

Sequence Info: Full Length of Mature Protein

MW: 28.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Reference: "Noggin and sclerostin bone morphogenetic protein antagonists form a mutually inhibitory complex." Winkler D.G., Yu C., Geoghegan J.C., Ojala E.W., Skonier J.E., Shpektor D., Sutherland M.K., Latham J.A. J. Biol. Chem. 279:36293-36298(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Sclerostin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99P67

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose