Recombinant Rat Progonadoliberin-1 (Gnrh1) | CSB-EP009635RA

Recombinant Rat Progonadoliberin-1 (Gnrh1) | CSB-EP009635RA | Cusabio

Alternative Name(s): Progonadoliberin-1(Progonadoliberin I) [Cleaved into: Gonadoliberin-1(Gonadoliberin I)(Gonadotropin-releasing hormone I)(GnRH-I)(Luliberin I)(Luteinizing hormone-releasing hormone I)(LH-RH I); Prolactin release-inhibiting factor 1(Prolactin release-inhibiting factor I)]

Gene Names: Gnrh1

Research Areas: Developmental Biology

Organism: Rattus norvegicus (Rat)

AA Sequence: QHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-92aa

Sequence Info: Full Length of Mature Protein

MW: 12.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.

Reference: "Adhesion-related kinase repression of gonadotropin-releasing hormone gene expression requires Rac activation of the extracellular signal-regulated kinase pathway." Allen M.P., Xu M., Linseman D.A., Pawlowski J.E., Bokoch G.M., Heidenreich K.A., Wierman M.E. J Biol Chem 277:38133-38140(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07490

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A