Recombinant Rat Oncostatin-M (Osm) | CSB-MP723970RA

(No reviews yet) Write a Review
SKU:
CSB-MP723970RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Oncostatin-M (Osm)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€529.00 - €1,301.00

Description

Recombinant Rat Oncostatin-M (Osm) | CSB-MP723970RA | Cusabio

Alternative Name(s): Osm; Oncostatin-M; OSM

Gene Names: Osm

Research Areas: Immunology

Organism: Rattus norvegicus (Rat)

AA Sequence: KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged

Expression Region: 26-208aa

Sequence Info: Full Length of Mature Protein

MW: 24.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.

Reference: "Oncostatin M inhibits proliferation of rat oval cells, OC15-5, inducing differentiation into hepatocytes." Okaya A., Kitanaka J., Kitanaka N., Satake M., Kim Y., Terada K., Sugiyama T., Takemura M., Fujimoto J., Terada N., Miyajima A., Tsujimura T. Am. J. Pathol. 166:709-719(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells (By similarity). Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: LIF/OSM family

Tissue Specificity: Widely expressed. Expressed at higher levels in liver, skin and spleen.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q65Z15

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose