Recombinant Rat Nitric oxide synthase, endothelial (Nos3), partial | CSB-RP165794r(A3)

(No reviews yet) Write a Review
SKU:
CSB-RP165794r(A3)
Availability:
13 - 23 Working Days
  • Recombinant Rat Nitric oxide synthase, endothelial (Nos3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Rat Nitric oxide synthase, endothelial (Nos3), partial | CSB-RP165794r(A3) | Cusabio

Alternative Name(s): Constitutive NOS ;cNOSEC-NOSEndothelial NOS ;eNOSNOS type III ;NOSIII

Gene Names: Nos3

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: ATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 519-690aa

Sequence Info: Partial

MW: 22.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.

Reference: Cloning and expression of the rat endothelial nitric oxide synthase.Seidel B., Jiang L., Wolf G. Differential expression and induction of mRNAs encoding two inducible nitric oxide synthases in rat kidney.Mohaupt M.G., Elzie J.L., Ahn K.Y., Clapp W.L., Wilcox C.S., Kone B.C.Kidney Int. 46:653-665(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.

Involvement in disease:

Subcellular Location: Membrane, caveola, Cytoplasm, cytoskeleton, Golgi apparatus, Cell membrane

Protein Families: NOS family

Tissue Specificity: Expressed constitutively by vascular endothelium. Detected in alveolar and serosal epithelial cells as well as in endothelial cells in one day old rat. In adult lung, detected in rare endothelial cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q62600

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose