Recombinant Rat Matrilysin (Mmp7) | CSB-EP014677RA

(No reviews yet) Write a Review
SKU:
CSB-EP014677RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Matrilysin (Mmp7)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Rat Matrilysin (Mmp7) | CSB-EP014677RA | Cusabio

Alternative Name(s): Matrin;Matrix metalloproteinase-7 ;MMP-7Pump-1 proteaseUterine metalloproteinase

Gene Names: Mmp7

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 98-267aa

Sequence Info: Full Length of Mature Protein

MW: 45.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase .

Reference: Characterization of rat uterine matrilysin and its cDNA. Relationship to human pump-1 and activation of procollagenases.Abramson S.R., Conner G.E., Nagase H., Neuhaus I., Woessner J.F.J. Biol. Chem. 270:16016-16022(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase (By similarity).

Involvement in disease:

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Peptidase M10A family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P50280

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose