Recombinant Rat Mast cell protease 1 (Mcpt1) | CSB-EP357723RA

Recombinant Rat Mast cell protease 1 (Mcpt1) | CSB-EP357723RA | Cusabio

Alternative Name(s): Chymase (Chymotrypsin-like protease) (CLIP protein) (Mast cell protease I) (rMCP-I) (rMCP-1)

Gene Names: Mcpt1

Research Areas: Cancer

Organism: Rattus norvegicus (Rat)

AA Sequence: IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS

Source: E.coli

Tag Info: N-terminal Myc-tagged

Expression Region: 21-260aa

Sequence Info: Full Length of Mature Protein

MW: 28.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. May participate in generating perivascular beta-protein which ultimately aggregates into amyloid-beta deposits.

Reference: "Identification of a chymotrypsin-like mast cell protease in rat brain capable of generating the N-terminus of the Alzheimer amyloid beta-protein." Nelson R.B., Siman R., Iqbal M.A., Potter H. J. Neurochem. 61:567-577(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. May participate in generating perivascular beta-protein which ultimately aggregates into amyloid-beta deposits.

Involvement in disease:

Subcellular Location: Secreted, Cytoplasmic granule

Protein Families: Peptidase S1 family, Granzyme subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09650

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A