Recombinant Rat Lutropin-choriogonadotropic hormone receptor (Lhcgr), partial | CSB-MP012911RA

Recombinant Rat Lutropin-choriogonadotropic hormone receptor (Lhcgr), partial | CSB-MP012911RA | Cusabio

Alternative Name(s): Luteinizing hormone receptor Short name: LSH-R

Gene Names: Lhcgr

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG

Source: Mammalian cell

Tag Info: C-terminal Flag-tagged

Expression Region: 27-362aa

Sequence Info: Partial

MW: 47.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.

Reference: "Lutropin-choriogonadotropin receptor: an unusual member of the G protein-coupled receptor family."McFarland K.C., Sprengel R., Phillips H.S., Koehler M., Rosemblit N., Nikolics K., Segaloff D.L., Seeburg P.H.Science 245:494-499(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein, Secreted

Protein Families: G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16235

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A