Cusabio Rattus norvegicus Recombinants
Recombinant Rat Lumican (Lum) | CSB-EP013234RA
- SKU:
- CSB-EP013234RA
- Availability:
- 13 - 23 Working Days
Description
Recombinant Rat Lumican (Lum) | CSB-EP013234RA | Cusabio
Alternative Name(s): Keratan sulfate proteoglycan lumican Short name: KSPG lumican
Gene Names: Lum
Research Areas: Signal Transduction
Organism: Rattus norvegicus (Rat)
AA Sequence: QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 19-338aa
Sequence Info: Full Length of Mature Protein
MW: 40.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.Nat. Commun. 3:876-876(2012)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted, extracellular space, extracellular matrix
Protein Families: Small leucine-rich proteoglycan (SLRP) family, SLRP class II subfamily
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P51886
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A