Recombinant Rat Insulin-1 (Ins1), partial | CSB-EP355622RA

Recombinant Rat Insulin-1 (Ins1), partial | CSB-EP355622RA | Cusabio

Alternative Name(s): Ins-1

Gene Names: Ins1

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-54aa

Sequence Info: Partial

MW: 19.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Reference: "Primary structures of the proinsulin connecting peptides of the rat and the horse." Tager H.S., Steiner D.F. J. Biol. Chem. 247:7936-7940(1972)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Insulin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01322

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A