Cusabio Rattus norvegicus Recombinants
Recombinant Rat Hemopexin (Hpx) | CSB-EP010723RA
- SKU:
- CSB-EP010723RA
- Availability:
- 3 - 7 Working Days
Description
Recombinant Rat Hemopexin (Hpx) | CSB-EP010723RA | Cusabio
Alternative Name(s): Hpx; Hemopexin
Gene Names: Hpx
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 24-460aa
Sequence Info: Full Length of Mature Protein
MW: 52.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Binds he and transports it to the liver for breakdown and iron recovery, after which the free hopexin returns to the circulation.
Reference: Rat hemopexin. Molecular cloning, primary structural characterization, and analysis of gene expression.Nikkilae H., Gitlin J.D., Mueller-Eberhard U.Biochemistry 30:823-829(1991)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Hemopexin family
Tissue Specificity: Expressed by the liver and secreted in plasma.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P20059
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A