Recombinant Rat GTPase HRas (Hras) | CSB-RP155374r

Recombinant Rat GTPase HRas (Hras) | CSB-RP155374r | Cusabio

Alternative Name(s): H-Ras-1Transforming protein p21c-H-rasp21ras

Gene Names: Hras

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-186aa

Sequence Info: Full Length of Mature Protein

MW: 24.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Reference: RGS14 is a multifunctional scaffold that integrates G protein and Ras/Raf MAPkinase signalling pathways.Shu F.J., Ramineni S., Hepler J.R.Cell. Signal. 22:366-376(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Involvement in disease:

Subcellular Location: Cell membrane, Cell membrane, Lipid-anchor, Cytoplasmic side, Golgi apparatus, Golgi apparatus membrane, Lipid-anchor

Protein Families: Small GTPase superfamily, Ras family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20171

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A