Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1) | CSB-EP009970RA

Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1) | CSB-EP009970RA | Cusabio

Alternative Name(s): GST 1-1;GST 1a-1a;GST A1-1;GST B;Glutathione S-transferase Ya-1 ;GST Ya1;Ligandin

Gene Names: Gsta1

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-222aa

Sequence Info: Full Length of Mature Protein

MW: 41.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Reference: Localization of the C-terminus of rat glutathione S-transferase A1-1 crystal structure of mutants W21F and W21F/F220Y.Adman E.T., Le Trong I., Stenkamp R.E., Nieslanik B.S., Dietze E.C., Tai G., Ibarra C., Atkins W.M.3.0.CO;2-%23>Proteins 42:192-200(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: GST superfamily, Alpha family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00502

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A