Recombinant Rat Gamma-synuclein (Sncg) | CSB-EP737203RA

(No reviews yet) Write a Review
SKU:
CSB-EP737203RA
Availability:
13 - 23 Working Days
  • Recombinant Rat Gamma-synuclein (Sncg)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Rat Gamma-synuclein (Sncg) | CSB-EP737203RA | Cusabio

Alternative Name(s): Persyn Sensory neuron synuclein

Gene Names: Sncg

Research Areas: Neuroscience

Organism: Rattus norvegicus (Rat)

AA Sequence: MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-123aa

Sequence Info: Full Length

MW: 17.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity).

Reference: "Synucleins in glaucoma: implication of gamma-synuclein in glaucomatous alterations in the optic nerve." Surgucheva I., McMahan B., Ahmed F., Tomarev S., Wax M.B., Surguchov A. J. Neurosci. Res. 68:97-106(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q63544

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose