Recombinant Rat Fatty acid-binding protein, heart (Fabp3) | CSB-EP007943RA

(No reviews yet) Write a Review
SKU:
CSB-EP007943RA
Availability:
13 - 23 Working Days
  • Recombinant Rat Fatty acid-binding protein, heart (Fabp3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Rat Fatty acid-binding protein, heart (Fabp3) | CSB-EP007943RA | Cusabio

Alternative Name(s): Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP

Gene Names: Fabp3

Research Areas: Cardiovascular

Organism: Rattus norvegicus (Rat)

AA Sequence: ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-133aa

Sequence Info: Full Length of Mature Protein

MW: 30.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Reference: "Cloning and tissue distribution of rat heart fatty acid binding protein mRNA: identical forms in heart and skeletal muscle."Claffey K.P., Herrera V.L., Brecher P., Ruiz-Opazo N.Biochemistry 26:7900-7904(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Calycin superfamily, Fatty-acid binding protein (FABP) family

Tissue Specificity: Heart, but also skeletal muscle, kidney, brain and mammary gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07483

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose