Recombinant Rat Erythropoietin receptor (Epor), partial | CSB-EP007744RAa3

(No reviews yet) Write a Review
SKU:
CSB-EP007744RAa3
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Rat Erythropoietin receptor (Epor), partial | CSB-EP007744RAa3 | Cusabio

Alternative Name(s): Epor; Erythropoietin receptor; EPO-R

Gene Names: Epor

Research Areas: Cardiovascular

Organism: Rattus norvegicus (Rat)

AA Sequence: ASSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMGFNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged and C-terminal 6xHis-tagged

Expression Region: 25-249aa

Sequence Info: Partial

MW: 39.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate LYN tyrosine kinase (By similarity).

Reference: "Functional erythropoietin receptor of the cells with neural characteristics. Comparison with receptor properties of erythroid cells." Masuda S., Nagao M., Takahata K., Konishi Y., Gallyas F., Tabira T., Sasaki R. J. Biol. Chem. 268:11208-11216(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q07303

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose