Recombinant Rat Complement factor D (Cfd) | CSB-YP005271RA

(No reviews yet) Write a Review
SKU:
CSB-YP005271RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Complement factor D (Cfd)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,708.00

Description

Recombinant Rat Complement factor D (Cfd) | CSB-YP005271RA | Cusabio

Alternative Name(s): Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D

Gene Names: Cfd

Research Areas: Immunology

Organism: Rattus norvegicus (Rat)

AA Sequence: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-263aa

Sequence Info: Full Length of Mature Protein

MW: 27.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.

Reference: "The endogenous vascular elastase that governs development and progression of monocrotaline-induced pulmonary hypertension in rats is a novel enzyme related to the serine proteinase adipsin."Zhu L., Wigle D., Hinek A., Kobayashi J., Ye C., Zuker M., Dodo H., Keeley F.W., Rabinovitch M.J. Clin. Invest. 94:1163-1171(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase S1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P32038

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose