null

Recombinant Rat Complement C3 (C3) , partial | CSB-YP360475RA

(No reviews yet) Write a Review
SKU:
CSB-YP360475RA
Availability:
25 - 35 Working Days
  • Recombinant Rat Complement C3 (C3) , partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $1,362.00
Frequently bought together:

Description

Recombinant Rat Complement C3 (C3) , partial | CSB-YP360475RA | Cusabio

Alternative Name(s): Neutrophil chemotactic factor-2

Gene Names: C3

Research Areas: Immunology

Organism: Rattus norvegicus (Rat)

AA Sequence: SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 671-746aa

Sequence Info: Partial

MW: 11 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.

Reference: "Complement component C3-derived neutrophil chemotactic factors purified from exudate of rat carrageenin-induced inflammation."Nakagawa H., Komorita N.Biochem. Biophys. Res. Commun. 194:1181-1187(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01026

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose