Recombinant Rat Collagen alpha-1 (I) chain, partial | CSB-YP005727RA

Recombinant Rat Collagen alpha-1 (I) chain, partial | CSB-YP005727RA | Cusabio

Alternative Name(s): Alpha-1 type I collagen

Gene Names: Col1a1

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 955-1207aa

Sequence Info: Partial

MW: 25.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Type I collagen is a mber of group I collagen (fibrillar forming collagen).

Reference: Expression of collagen alpha1(I) mRNA variants during tooth and bone formation in the rat.Brandsten C., Lundmark C., Christersson C., Hammarstroem L., Wurtz T.J. Dent. Res. 78:11-19(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Type I collagen is a member of group I collagen (fibrillar forming collagen).

Involvement in disease:

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Fibrillar collagen family

Tissue Specificity: Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02454

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A