Recombinant Rat Carboxypeptidase A1 (Cpa1) | CSB-EP005875RA

Recombinant Rat Carboxypeptidase A1 (Cpa1) | CSB-EP005875RA | Cusabio

Alternative Name(s): Cpa

Gene Names: Cpa1

Research Areas: Signal Transduction

Organism: Rattus norvegicus (Rat)

AA Sequence: ALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 111-419aa

Sequence Info: Full Length of Mature Protein

MW: 39.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro.

Reference: "Rat preprocarboxypeptidase A: cDNA sequence and preliminary characterization of the gene." Quinto C., Quiroga M., Swain W.F., Nikovits W.C. Jr., Standring D.N., Pictet R.L., Valenzuela P., Rutter W.J. Proc. Natl. Acad. Sci. U.S.A. 79:31-35(1982)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase M14 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00731

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A