Cusabio Rattus norvegicus Recombinants
Recombinant Rat Carbonic anhydrase 1 (Ca1) | CSB-EP004364RAa2
- SKU:
- CSB-EP004364RAa2
- Availability:
- 3 - 7 Working Days
Description
Recombinant Rat Carbonic anhydrase 1 (Ca1) | CSB-EP004364RAa2 | Cusabio
Alternative Name(s): Carbonate dehydratase I
Gene Names: Ca1
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 2-261aa
Sequence Info: Full Length of Mature Protein
MW: 44.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Reversible hydration of carbon dioxide.Curated
Reference: Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome profile of the mature rat olfactory bulb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599(2009)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Reversible hydration of carbon dioxide.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Alpha-carbonic anhydrase family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: B0BNN3
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A