Cusabio Rattus norvegicus Recombinants
Recombinant Rat Beta-nerve growth factor (Ngf), Partial | CSB-RP168594r
- SKU:
- CSB-RP168594r
- Availability:
- 13 - 23 Working Days
Description
Recombinant Rat Beta-nerve growth factor (Ngf), Partial | CSB-RP168594r | Cusabio
Alternative Name(s): Ngf; Ngfb; Beta-nerve growth factor; Beta-NGF
Gene Names: Ngf
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 124-241aa
Sequence Info: Partial
MW: 17.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systs. Extracellular domain ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Reference: Rat beta-nerve growth factor sequence and site of synthesis in the adult hippocampus.Whittemore S.R., Friedman P.L., Larhammar D.G., Persson H., Gonzalez-Carvajal M., Holets V.R.J. Neurosci. Res. 20:403-410(1988)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: NGF-beta family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P25427
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A