Recombinant Rat Anionic trypsin-2 (Prss2) | CSB-YP018814RA

(No reviews yet) Write a Review
SKU:
CSB-YP018814RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Anionic trypsin-2 (Prss2)
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP018814RA could indicate that this peptide derived from Yeast-expressed Rattus norvegicus (Rat) Prss2.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP018814RA could indicate that this peptide derived from Yeast-expressed
£306.40 - £1,076.00

Description

Recombinant Rat Anionic trypsin-2 (Prss2) | CSB-YP018814RA | Cusabio

Alternative Name(s): Anionic trypsin II (Pretrypsinogen II) (Serine protease 2) (Try2)

Gene Names: Prss2

Research Areas: Cell Biology

Organism: Rattus norvegicus (Rat)

AA Sequence: IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-246aa

Sequence Info: Full Length of Mature Protein

MW: 25.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "The energetic cost of induced fit catalysis: Crystal structures of trypsinogen mutants with enhanced activity and inhibitor affinity." Pasternak A., White A., Jeffery C.J., Medina N., Cahoon M., Ringe D., Hedstrom L. Protein Sci. 10:1331-1342(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted, extracellular space

Protein Families: Peptidase S1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00763

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose