Cusabio Rattus norvegicus Recombinants
Recombinant Rat Anionic trypsin-1 (Prss1) | CSB-YP018811RA
- SKU:
- CSB-YP018811RA
- Availability:
- 3 - 7 Working Days
Description
Recombinant Rat Anionic trypsin-1 (Prss1) | CSB-YP018811RA | Cusabio
Alternative Name(s): Anionic trypsin IPretrypsinogen ISerine protease 1
Gene Names: Prss1
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 24246aa
Sequence Info: Full Length of Mature Protein
MW: 25.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: Structure of two related rat pancreatic trypsin genes.Craik C.S., Choo Q.L., Swift G.H., Quinto C., MacDonald R.J., Rutter W.J.J. Biol. Chem. 259:14255-14264(1984)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted, extracellular space
Protein Families: Peptidase S1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P00762
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A