Recombinant Rat Anionic trypsin-1 (Prss1) | CSB-EP018811RAb0

Recombinant Rat Anionic trypsin-1 (Prss1) | CSB-EP018811RAb0 | Cusabio

Alternative Name(s): Anionic trypsin I (Pretrypsinogen I) (Serine protease 1) (Try1)

Gene Names: Prss1

Research Areas: Metabolism

Organism: Rattus norvegicus (Rat)

AA Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 24-246aa

Sequence Info: Full Length of Mature Protein

MW: 27.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Intra-acinar cell activation of trypsinogen during caerulein-induced pancreatitis in rats." Hofbauer B., Saluja A.K., Lerch M.M., Bhagat L., Bhatia M., Lee H.S., Frossard J.L., Adler G., Steer M.L. Am. J. Physiol. 275:G352-62(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted, extracellular space

Protein Families: Peptidase S1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00762

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A