Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial | CSB-YP023994RB1

Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial | CSB-YP023994RB1 | Cusabio

Alternative Name(s): Tumor necrosis factor ligand superfamily member 4(OX40 ligand)(OX40L)(CD antigen CD252)

Gene Names: TNFSF4

Research Areas: Immunology

Organism: Oryctolagus cuniculus (Rabbit)

AA Sequence: QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

Source: Yeast

Tag Info: C-terminal 6xHis-tagged and Myc-tagged

Expression Region: 45-187aa

Sequence Info: Partial

MW: 19.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.

Reference: "Expression of OX40 and OX40 ligand genes in rabbit HTLV-I-transformed T cell lines." Isono T., Seto A. Submitted (MAY-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O02765

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A