Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) | CSB-BP023437RB

(No reviews yet) Write a Review
SKU:
CSB-BP023437RB
Availability:
3 - 7 Working Days
  • Recombinant Rabbit Tissue factor pathway inhibitor (TFPI)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$531.60 - $1,272.00

Description

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) | CSB-BP023437RB | Cusabio

Alternative Name(s): Extrinsic pathway inhibitor (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)

Gene Names: TFPI

Research Areas: Others

Organism: Oryctolagus cuniculus (Rabbit)

AA Sequence: AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

Expression Region: 25-300aa

Sequence Info: Full Length of Mature Protein

MW: 34.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

Reference: cDNA sequence of rabbit lipoprotein-associated coagulation inhibitor.Wesselschmidt R.L., Girard T.J., Broze G.J. Jr.Nucleic Acids Res. 18:6440-6440(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19761

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose