Recombinant Rabbit Integrin beta-8 (ITGB8), partial | CSB-EP011892RB

(No reviews yet) Write a Review
SKU:
CSB-EP011892RB
Availability:
3 - 7 Working Days
  • Recombinant Rabbit Integrin beta-8 (ITGB8), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Rabbit Integrin beta-8 (ITGB8), partial | CSB-EP011892RB | Cusabio

Alternative Name(s): ITGB8Integrin beta-8

Gene Names: ITGB8

Research Areas: Signal Transduction

Organism: Oryctolagus cuniculus (Rabbit)

AA Sequence: PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 146-384aa

Sequence Info: Partial

MW: 31.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Integrin alpha-V/beta-8 is a receptor for fibronectin.

Reference: "Cloning and expression of a divergent integrin subunit beta 8." Moyle M., Napier M.A., McLean J.W. J. Biol. Chem. 266:19650-19658(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Integrin alpha-V/beta-8 is a receptor for fibronectin.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: Integrin beta chain family

Tissue Specificity: Placenta, kidney, brain, ovary, uterus and in several transformed cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P26013

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose