Recombinant Pseudomonas azotoformans L-amino acid amidase (laaA) | CSB-EP748477PHAE

Recombinant Pseudomonas azotoformans L-amino acid amidase (laaA) | CSB-EP748477PHAE | Cusabio

Alternative Name(s): laaAL-amino acid amidase; EC 3.5.1.101

Gene Names: laaA

Research Areas: Others

Organism: Pseudomonas azotoformans

AA Sequence: MEFIEKIREGYAAFGAYQTWYRVTGDLSSGRTPLVVIHGGPGCTHDYVDAFKDVAASGHAVIHYDQLGNGRSTHLPDKDPSFWTVGLFLEELNNLLDHLQISDNYAILGQSWGGMLGSEHAILQPKGLRAFIPANSPTCMRTWVSEANRLRKLLPEGVHETLLKHETAGTYQDPEYLAASRVFYDHHVCRVIPWPEEVARTFAAVDADPTVYHAMSGPTEFHVIGSLKDWKSTGRLSAINVPTLVISGRHDEATPLVVKPFLDEIADVRWALFEDSSHMPHVEERQACMGTVVKFLDEVCSAKYKVLKAS

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-310aa

Sequence Info: Full Length

MW: 54.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Hydrolyzes L-prolinamide, L-proline-p-nitroanilide, L-alaninamide, L-methioninamide, piperidine-2-carboxamide and piperazine-2-carboxamide. Has a much lower activity towards piperazine-2-tert-butylcarboxamide. Does not hydrolyze dipeptides and D-prolinamide.

Reference: "S-stereoselective piperazine-2-tert-butylcarboxamide hydrolase from Pseudomonas azotoformans IAM 1603 is a novel L-amino acid amidase." Komeda H., Harada H., Washika S., Sakamoto T., Ueda M., Asano Y. Eur. J. Biochem. 271:1465-1475(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Hydrolyzes L-prolinamide, L-proline-p-nitroanilide, L-alaninamide, L-methioninamide, piperidine-2-carboxamide and piperazine-2-carboxamide. Has a much lower activity towards piperazine-2-tert-butylcarboxamide. Does not hydrolyze dipeptides and D-prolinamide.

Involvement in disease:

Subcellular Location:

Protein Families: Peptidase S33 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q76KX0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A