Recombinant Pseudomonas aeruginosa Exotoxin A regulatory protein (toxR) | CSB-EP357792FQE

(No reviews yet) Write a Review
SKU:
CSB-EP357792FQE
Availability:
3 - 7 Working Days
€352.00 - €1,702.00

Description

Recombinant Pseudomonas aeruginosa Exotoxin A regulatory protein (toxR) | CSB-EP357792FQE | Cusabio

Alternative Name(s): regA

Gene Names: toxR

Research Areas: Others

Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

AA Sequence: MTATDRTPPPLKWLCLGNRDANDGFELFAHGIYARNGALVGSKLSLRERRQRVDLSAFLSGAPPLLAEAAVKHLLARLLCVHRHNTDLELLGKNFIPLHASSLGNAGVCERILASARQLQQHQVELCLLLAIDEQEPASAEYLTSLARLRDSGVRIALHPQRIDTDARQCFAEVDAGLCDYLGLDARLLAPGPLTRNLRQRKSIEYLNRLLVAQDIQMLCLNVDNEELHQQANALPFAFRHGRHYSEPFQAWPFSSPAC

Source: E.coli

Tag Info: N-terminal 6xHis-KSI-tagged

Expression Region: 1-259aa

Sequence Info: Full Length

MW: 44.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Positive regulation of toxA gene transcription.

Reference: "Expression of the Pseudomonas aeruginosa toxA positive regulatory gene (regA) in Escherichia coli." Hamood A., Iglewski B.H. J. Bacteriol. 172:589-594(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09852

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose