Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin (TLF1) | CSB-EP356569EZB

(No reviews yet) Write a Review
SKU:
CSB-EP356569EZB
Availability:
3 - 7 Working Days
  • Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin (TLF1)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356569EZB could indicate that this peptide derived from E.coli-expressed Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) TLF1.
£281.60 - £1,361.60

Description

Recombinant Protobothrops flavoviridis Thrombin-like enzyme flavoxobin (TLF1) | CSB-EP356569EZB | Cusabio

Alternative Name(s): Fibrinogen-clotting enzyme (Habutobin) (Snake venom serine protease 1) (SVSP) (SVTLE)

Gene Names: TLF1

Research Areas: Others

Organism: Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis)

AA Sequence: VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 25-260aa

Sequence Info: Full Length of Mature Protein

MW: 33.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Thrombin-like snake venom serine protease that clots fibrinogen by releasing fibrinopeptide A. According to PubMed:8585090, only cleaves rabbit fibrinogen, whereas no specificity is described in PubMed:3910643. Also acts as a C3 convertase that independently cleaves human C3 and kick-starts the complement cascade. Also increases urokinase-type plasminogen activator and plasminogen activator inhibitor in cultured bovine pulmonary artery endothelial cells. Dose-dependently inhibits collagen-induced platelet aggregation.

Reference: "Habutobin releases plasminogen activator (U-PA) from bovine pulmonary artery endothelial cells." Sunagawa M., Hanashiro K., Nakamura M., Kosugi T. Toxicon 34:691-699(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05620

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose