Recombinant Pongo pygmaeus Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (GPX4), partial | CSB-EP670014EXP

Recombinant Pongo pygmaeus Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (GPX4), partial | CSB-EP670014EXP | Cusabio

Alternative Name(s): Glutathione peroxidase 4 Short name:GPx-4 Short name:GSHPx-4

Gene Names: GPX4

Research Areas: Others

Organism: ongo pygmaeus (Bornean orangutan)

AA Sequence: MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-170aa

Sequence Info: Cytoplasmic Domain

MW: 35 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage

Reference: "Structure, gene expression, and evolution of primate glutathione peroxidases."Fukuhara R., Kageyama T.Comp. Biochem. Physiol. 141B:428-436(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility. Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage. Essential for maturation and survival of photoreceptor cells. Plays a role in a primary T cell response to viral and parasitic infection by protecting T cells from ferroptosis, a cell death resulting from an iron-dependent accumulation of lipid reactive oxygen species, and by supporting T cell expansion.

Involvement in disease:

Subcellular Location: Mitochondrion, Cytoplasm

Protein Families: Glutathione peroxidase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q4AEH2

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A