Cusabio Virus & Bacteria Recombinants
Recombinant Platanus acerifolia Putative invertase inhibitor | CSB-YP818103PGAT
- SKU:
- CSB-YP818103PGAT
- Availability:
- 25 - 35 Working Days
Description
Recombinant Platanus acerifolia Putative invertase inhibitor | CSB-YP818103PGAT | Cusabio
Alternative Name(s): Pollen allergen Pla a 1 Allergen: Pla a 1
Gene Names: N/A
Research Areas: Allergen
Organism: London plane tree
AA Sequence: ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 24-179aa
Sequence Info: Full Length of Mature Protein
MW: 18.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Invertase inhibitor.
Reference: "The major Platanus acerifolia pollen allergen Pla a 1 has sequence homology to invertase inhibitors."Asturias J.A., Ibarrola I., Eraso E., Arilla M.C., Martinez A.Clin. Exp. Allergy 33:978-985(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Invertase inhibitor.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: PMEI family
Tissue Specificity: Pollen and stem, but not leaves.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q8GT41
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A