Recombinant Plasmodium falciparum VAR2CSA DBL5 | CSB-BP2690PLO

Recombinant Plasmodium falciparum VAR2CSA DBL5 | CSB-BP2690PLO | Cusabio

Alternative Name(s): /

Gene Names: N/A

Research Areas: Others

Organism: Plasmodium falciparum

AA Sequence: RCFDDQTKMKVCDLIGDAIGCKDKTKLDELDEWNDMDLRDPYNKYKGVLIPPRRRQLCFSRIVRGPANLRNLNEFKEEILKGAQSEGKFLGNYYNEDKDKEKKEDRKEKALEAMKNSFYDYEYIIKGSDILENIQFKDIKRKLDKLLTKETNNNTKKAEDWWETNKKSIWNAMLCGYKKSGNKIIDPSWCTIPTTEKTPQFLRWIKEWGTNVCIQKEKYKEYVKSECSNVPNNNLGSQASESTKCTSEIRKYQEWSRKRSIQWEAISERYKKYKGMDEFKNVFNNANEPDANEYLKEHCSKCPCGFNDMEEITKYTNIGNEAFNTIIEKVKIPAELEDVIYRLKHHEYNSNDY

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-353aa

Sequence Info: Full Length

MW: 45.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: Induction of adhesion-inhibitory antibodies against placental Plasmodium falciparum parasites by using single domains of VAR2CSA Nielsen,M.A., Pinto,V.V., Resende,M., Dahlback,M., Ditlev,S.B., Theander,T.G. and Salanti,A. Infect. Immun. 77 (6), 2482-2487 (2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: ACM48350.1

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A