null

Recombinant Plasmodium falciparum Glutathione S-transferase (GST) | CSB-YP847596PLO

(No reviews yet) Write a Review
SKU:
CSB-YP847596PLO
Availability:
3 - 7 Working Days
€383.00 - €1,345.00
Frequently bought together:

Description

Recombinant Plasmodium falciparum Glutathione S-transferase (GST) | CSB-YP847596PLO | Cusabio

Alternative Name(s): PfGST

Gene Names: GST

Research Areas: Metabolism

Organism: Plasmodium falciparum

AA Sequence: MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-211aa

Sequence Info: Full Length

MW: 27.3

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May also function as a storage protein or ligandin for parasitotoxic ferriprotoporphyrin IX .

Reference: "Glutathione S-transferase of the malarial parasite Plasmodium falciparum: characterization of a potential drug target." Harwaldt P., Rahlfs S., Becker K. Biol. Chem. 383:821-830(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8MU52

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose