Recombinant Pinctada fucata N16.1 matrix protein | CSB-YP871337EVV

(No reviews yet) Write a Review
SKU:
CSB-YP871337EVV
Availability:
25 - 35 Working Days
  • Recombinant Pinctada fucata N16.1 matrix protein
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Pinctada fucata N16.1 matrix protein | CSB-YP871337EVV | Cusabio

Alternative Name(s): N16.1 matrix protein; N14#1

Gene Names: N/A

Research Areas: Others

Organism: Pinctada fucata (Akoya pearl oyster) (Pinctada imbricata fucata)

AA Sequence: AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-131aa

Sequence Info: Full Length of Mature Protein

MW: 14.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be specifically involved in the formation of the nacreous layer.

Reference: A new matrix protein family related to the nacreous layer formation of Pinctada fucata.Samata T., Hayashi N., Kono M., Hasegawa K., Horita C., Akera S.FEBS Lett. 462:225-229(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be specifically involved in the formation of the nacreous layer.

Involvement in disease:

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: N16 matrix protein family

Tissue Specificity: Component of conchiolin, the organic matrix of nacre. Expressed at extremely high levels in the dorsal region of the mantle, which region may be responsible for the nacreous layer formation, but only in trace amounts at the mantle edge, which region may be responsible for the prismatic layer formation.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9TVT2

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose