Recombinant Pig Transcobalamin-1 (TCN1) | CSB-YP023317PI

(No reviews yet) Write a Review
SKU:
CSB-YP023317PI
Availability:
25 - 35 Working Days
  • Recombinant Pig Transcobalamin-1 (TCN1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Pig Transcobalamin-1 (TCN1) | CSB-YP023317PI | Cusabio

Alternative Name(s): CobalophilinHaptocorrin;Protein RTranscobalamin I ;TC I ;TCI

Gene Names: TCN1

Research Areas: Others

Organism: Sus scrofa (Pig)

AA Sequence: CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-416aa

Sequence Info: Full Length of Mature Protein

MW: 46.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach . Binds to cobalamin and to cobalamin analogs such as cobinamide.

Reference: Isolation and characterization of a cDNA encoding porcine gastric haptocorrin.Hewitt J.E., Seetharam B., Leykam J.F., Alpers D.H.Eur. J. Biochem. 189:125-130(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach (By similarity). Binds to cobalamin and to cobalamin analogs such as cobinamide.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Eukaryotic cobalamin transport proteins family

Tissue Specificity: Haptocorrins are a family of cobalamin-binding glycoproteins found in blood, salivary and mucosal secretions.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17630

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose