Recombinant Pig Rhodopsin (RHO), partial | CSB-YP019681PI1

(No reviews yet) Write a Review
SKU:
CSB-YP019681PI1
Availability:
25 - 35 Working Days
$459.60 - $1,614.00

Description

Recombinant Pig Rhodopsin (RHO), partial | CSB-YP019681PI1 | Cusabio

Alternative Name(s): RHO1

Gene Names: RHO

Research Areas: Signal Transduction

Organism: Sus scrofa (Pig)

AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-36aa

Sequence Info: Partial

MW: 6.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling

Reference: "Structural and functional protein network analyses predict novel signaling functions for rhodopsin." Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Mol. Syst. Biol. 7:551-551(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth

Involvement in disease:

Subcellular Location: Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment

Protein Families: G-protein coupled receptor 1 family, Opsin subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O18766

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose