Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB) | CSB-YP021173PI

(No reviews yet) Write a Review
SKU:
CSB-YP021173PI
Availability:
25 - 35 Working Days
€491.00 - €1,453.00

Description

Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB) | CSB-YP021173PI | Cusabio

Alternative Name(s): Pulmonary surfactant-associated protein B(SP-B)(8 kDa protein)(Pulmonary surfactant-associated proteolipid SPL(Phe))

Gene Names: SFTPB

Research Areas: Cardiovascular

Organism: Sus scrofa (Pig)

AA Sequence: FPIPLPFCWLCRTLIKRIQAVVPKGVLLKAVAQVCHVVPLPVGGICQCLAERYIVICLNMLLDRTLPQLVCGLVLRCSS

Source: Yeast

Tag Info: Tag-Free

Expression Region: 1-79aa

Sequence Info: Full Length of Mature Protein

MW: 8.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Reference: "Low-molecular-mass surfactant protein type 1. The primary structure of a hydrophobic 8-kDa polypeptide with eight half-cystine residues." Curstedt T., Johansson J., Barros-Soederling J., Robertson B., Nilsson G., Westberg M., Joernvall H. Eur. J. Biochem. 172:521-525(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15782

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose