Recombinant Pig Erythropoietin (EPO) | CSB-EP007743PI

Recombinant Pig Erythropoietin (EPO) | CSB-EP007743PI | Cusabio

Alternative Name(s): EPOErythropoietin

Gene Names: EPO

Research Areas: Cardiovascular

Organism: Sus scrofa (Pig)

AA Sequence: APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 27-194aa

Sequence Info: Full Length of Mature Protein

MW: 32.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.

Reference: "The porcine erythropoietin gene: cDNA sequence, genomic sequence and expression analyses in piglets." David R.B., Blom A.K., Sjaastad O.V., Harbitz I. Domest. Anim. Endocrinol. 20:137-147(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: EPO/TPO family

Tissue Specificity: Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49157

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A