Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5) | CSB-EP009870PI

Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5) | CSB-EP009870PI | Cusabio

Alternative Name(s): Epididymis-specific glutathione peroxidase-like protein Short name:EGLP

Gene Names: GPX5

Research Areas: Signal Transduction

Organism: Sus scrofa (Pig)

AA Sequence: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 22-219aa

Sequence Info: Full Length of Mature Protein

MW: 27.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.

Reference: "Molecular cloning and characterization of the epididymis-specific glutathione peroxidase-like protein secreted in the porcine epididymal fluid."Okamura N., Iwaki Y., Hiramoto S., Tamba M., Bannai S., Sugita Y., Syntin P., Dacheux F., Dacheux J.-L.Biochim. Biophys. Acta 1336:99-109(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Glutathione peroxidase family

Tissue Specificity: Proximal caput epididymis.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O18994

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A