Recombinant Pig Calreticulin (CALR) | CSB-YP004458PI

(No reviews yet) Write a Review
SKU:
CSB-YP004458PI
Availability:
3 - 7 Working Days
  • Recombinant Pig Calreticulin (CALR)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,618.40

Description

Recombinant Pig Calreticulin (CALR) | CSB-YP004458PI | Cusabio

Alternative Name(s): Alternative name(s):CRP55;Calregulin;Endoplasmic reticulum resident protein 60 Short name:ERp60 HACBP

Gene Names: CALR

Research Areas: Tags & Cell Markers

Organism: Sus scrofa (Pig)

AA Sequence: EPTIYFKEQFLDGDGWTDRWIESKHKPDFGRFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAVKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEEKKRKEEEEVDKEDEEDKDEDEEEEDEKEEEEEEDAAAGQAKDEL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 18-417aa

Sequence Info: Full Length of Mature Protein

MW: 48.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export (By similarity). Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis.

Reference: "Evaluation and characterization of a porcine small intestine cDNA library: analysis of 839 clones."Winteroe A.K., Fredholm M., Davies W.Mamm. Genome 7:509-517(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export (By similarity). Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis.

Involvement in disease:

Subcellular Location: Endoplasmic reticulum lumen, Sarcoplasmic reticulum lumen, Cytoplasm, perinuclear region, Membrane

Protein Families: Calreticulin family

Tissue Specificity: In blastocyst expressed in all blastomeres (at protein level). In embryos, expressed in spleen, kidney, liver, fat, muscle, ovary, granulosa cells and cumulus cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P28491

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose