Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36) | CSB-EP344230PI

(No reviews yet) Write a Review
SKU:
CSB-EP344230PI
Availability:
13 - 23 Working Days
  • Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36) | CSB-EP344230PI | Cusabio

Alternative Name(s): Myeloid antibacterial peptide 36

Gene Names: PMAP36

Research Areas: Others

Organism: Sus scrofa (Pig)

AA Sequence: VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 130-166aa

Sequence Info: Full Length of Mature Protein

MW: 20.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.

Reference: "Chemical synthesis and biological activity of a novel antibacterial peptide deduced from a pig myeloid cDNA."Storici P., Scocchi M., Tossi A., Gennaro R., Zanetti M.FEBS Lett. 337:303-307(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Cathelicidin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49931

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose