Cusabio Sus scrofa Recombinants
Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36) | CSB-EP344230PI
- SKU:
- CSB-EP344230PI
- Availability:
- 13 - 23 Working Days
Description
Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36) | CSB-EP344230PI | Cusabio
Alternative Name(s): Myeloid antibacterial peptide 36
Gene Names: PMAP36
Research Areas: Others
Organism: Sus scrofa (Pig)
AA Sequence: VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 130-166aa
Sequence Info: Full Length of Mature Protein
MW: 20.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.
Reference: "Chemical synthesis and biological activity of a novel antibacterial peptide deduced from a pig myeloid cDNA."Storici P., Scocchi M., Tossi A., Gennaro R., Zanetti M.FEBS Lett. 337:303-307(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Cathelicidin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P49931
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A